You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577441 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZFP57 |
| Target | ZFP57 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP57 |
| Protein Sequence | Synthetic peptide located within the following region: MFEQLKPIEPRDCWREARVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQ |
| UniProt ID | Q9NU63 |
| MW | 59kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TNDM1, ZNF698, C6orf40, bA145L22, bA145L22.2 |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | XP_945837 |

Human kidney

WB Suggested Anti-ZFP57 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review