ZFP42 Rabbit Polyclonal Antibody

SKU: orb329864

Description

Rabbit polyclonal antibody to ZFP42

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP42
• Target: ZFP42
• Protein Sequence: Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti REX1 antibody, anti ZNF754 antibody

WB Suggested Anti-ZFP42 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Sample Type: 721_B Whole cell lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

ZFP42

UniProt

Q96MM3

RefSeq (Protein):NP_777560