You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576864 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZFP36L2 |
| Target | ZFP36L2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L2 |
| Protein Sequence | Synthetic peptide located within the following region: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP |
| UniProt ID | Q53TB4 |
| MW | 51kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | BRF2, ERF2, ERF-2, TIS11D, RNF162C |
| Research Area | Epigenetics & Chromatin, Stem Cell & Developmental Read more... |
| Note | For research use only |
| NCBI | NP_008818 |
| Expiration Date | 12 months from date of receipt. |

WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. ZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IHC, WB | |
Bovine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Canine, Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review