ZFP36L1 Rabbit Polyclonal Antibody

• Catalog Number: orb574634
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZFP36L1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: ZFP36L1
• UniProt ID: Q07352
• Protein Sequence: Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG
• NCBI: NP_004917
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ZFP36L1 Antibody, Titration: 1.25 ug/ml, Positive Control: Jurkat Whole Cell, There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat.