You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574634 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZFP36L1 |
Target | ZFP36L1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1 |
Protein Sequence | Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG |
UniProt ID | Q07352 |
MW | 36kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B |
Note | For research use only |
NCBI | NP_004917 |
Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ZFP36L1 Antibody, Titration: 1.25 ug/ml, Positive Control: Jurkat Whole Cell, There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |