Zfp148 Rabbit Polyclonal Antibody

• Catalog Number: orb324804
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Zfp148
• Target: Zfp148
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Zfp148
• Protein Sequence: Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
• UniProt ID: Q548L0
• MW: 87kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 2210405J08Rik antibody, anti AI480666 antibod
• Note: For research use only
• NCBI: NP_035879
• Expiration Date: 12 months from date of receipt.

References

Jihye Kim 1 2, Soojeong Park 1 2, Jee-Ho Lee 1 2, Ji-Yeong Lee 1 2, Joo-Ho Shin Zinc finger protein 184 prevents α-synuclein preformed fibril-mediated neurodegeneration through the interleukin enhancer binding factor 3-microRNA-7 pathway PLoS One, (2025)

PubMed: 40333790

Sample Type: Mouse Heart lysates, Antibody Dilution: 1.0 ug/mL.