You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324380 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZFP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | ZFP1 |
UniProt ID | Q6P2D0 |
Protein Sequence | Synthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI |
NCBI | NP_710155 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ZNF475 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Jurkat Whole Cell
Rabbit Anti-ZFP1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
Rabbit Anti-ZFP1 Antibody, Paraffin Embedded Tissue: Human Spermatophore, Cellular Data: Epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
IHC, WB | |
Bovine, Canine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |