Cart summary

You have no items in your shopping cart.

ZFHX4 Rabbit Polyclonal Antibody (HRP)

ZFHX4 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2127089

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2127089
CategoryAntibodies
DescriptionZFHX4 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence DSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTD
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW394 kDa
UniProt IDQ86UP3
Protein SequenceSynthetic peptide located within the following region: DSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTD
NCBINP_078997
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesZFH4, ZHF4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.
  • ZFHX4 Rabbit Polyclonal Antibody (HRP) [orb476615]

    ELISA,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl