Cart summary

You have no items in your shopping cart.

ZFAND6 Rabbit Polyclonal Antibody (FITC)

ZFAND6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2134987

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2134987
CategoryAntibodies
DescriptionZFAND6 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZFAND6
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW22kDa
UniProt IDQ6FIF0
Protein SequenceSynthetic peptide located within the following region: LTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK
NCBINP_061879
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesAWP1, ZA20D3, ZFAND5B
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.