ZEB2 Rabbit Polyclonal Antibody

SKU: orb330041

Description

Rabbit polyclonal antibody to ZEB2

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 7

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ZEB2
Target	ZEB2
Protein Sequence	Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Molecular Weight	25 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti KIAA0569 antibody, anti SIP-1 antibody, anti SIP1 antibody, anti SMADIP1 antibody, anti ZFHX1B antibody, anti HSPC082 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.4 ug/mL of the antibody was used in this experiment. The protein may be modfied by glycosylation and phosphorylation.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

IHC Information: Paraffin embedded small intestine, myenteric plexus tissue, tested with an antibody Dilution of 2.5 ug/mL.

WB Suggested Anti-ZEB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.

ZEB2 antibody - middle region (orb330041) validated by WB using H9 human embryonic stem cells at 1:1000.

Quick Database Links

Gene Symbol

ZEB2

UniProt

O60315

RefSeq (Protein):NP_055610

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055610

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols