ZEB2 Rabbit Polyclonal Antibody

• Catalog Number: orb330041
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZEB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZEB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25 kDa
• Target: ZEB2
• UniProt ID: O60315
• Protein Sequence: Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
• NCBI: NP_055610
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA0569 antibody, anti SIP-1 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.4 ug/mL of the antibody was used in this experiment. The protein may be modfied by glycosylation and phosphorylation.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

IHC Information: Paraffin embedded small intestine, myenteric plexus tissue, tested with an antibody Dilution of 2.5 ug/mL.

WB Suggested Anti-ZEB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.

ZEB2 antibody - middle region (orb330041) validated by WB using H9 human embryonic stem cells at 1:1000.