ZEB2 antibody

• Catalog Number: orb330041
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZEB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Reactivity: Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZEB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25 kDa
• Target: ZEB2
• UniProt ID: O60315
• Protein Sequence: Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
• NCBI: NP_055610
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA0569 antibody, anti SIP-1 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Small intestine tissue using ZEB2 antibody

Western blot analysis of human H9 tissue using ZEB2 antibody

Western blot analysis of Hela cell lysate tissue using ZEB2 antibody