You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574194 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZEB1 |
Target | ZEB1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZEB1 |
Protein Sequence | Synthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH |
UniProt ID | P37275 |
MW | 124kDa |
Tested applications | IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BZP, TCF8, AREB6, FECD6, NIL2A, PPCD3, ZFHEP, ZFHX Read more... |
Note | For research use only |
NCBI | NP_110378 |
Wang, Xiaoyu et al. Transcription Factors ZEB1 and CREB Promote the Transcription of Bovine ABHD5 Gene DNA Cell Biol, 40, 219-230 (2021)
Human Jurkat
Sample Type: Eye tissue.
Sample Type: Eye tissue.
WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, ZEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Gallus, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |