ZEB1 Rabbit Polyclonal Antibody

• Catalog Number: orb574194
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZEB1
• Target: ZEB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZEB1
• Protein Sequence: Synthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH
• UniProt ID: P37275
• MW: 124kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BZP, TCF8, AREB6, FECD6, NIL2A, PPCD3, ZFHEP, ZFHX
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_110378

References

Wang, Xiaoyu et al. Transcription Factors ZEB1 and CREB Promote the Transcription of Bovine ABHD5 Gene DNA Cell Biol, 40, 219-230 (2021)

PubMed: 33332227

Human Jurkat

Sample Type: Eye tissue.

Sample Type: Eye tissue.

WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, ZEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.