ZBTB7A Rabbit Polyclonal Antibody

• Catalog Number: orb577007
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB7A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB7A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: ZBTB7A
• UniProt ID: O95365
• Protein Sequence: Synthetic peptide located within the following region: MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRS
• NCBI: NP_056982
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LRF, FBI1, FBI-1, TIP21, ZBTB7, ZNF857A, pokemon
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-ZBTB7A antibody (orb577007).

WB Suggested Anti-ZBTB7A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.