You have no items in your shopping cart.
Cart summary
Item 1 of 1
YY1AP1 Rabbit Polyclonal Antibody
Catalog Number: orb581210
Product Properties
| Catalog Number | orb581210 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to YY1AP1 |
| Target | YY1AP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Equine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YY1AP1 |
| Protein Sequence | Synthetic peptide located within the following region: WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF |
| UniProt ID | D3DV96 |
| MW | 83kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GRNG, HCCA1, HCCA2, YY1AP |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_620830 |
Images
WB Suggested Anti-YY1AP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. YY1AP1 is supported by BioGPS gene expression data to be expressed in HeLa.
Similar Products
- Item 1 of 1
Reviews
YY1AP1 Rabbit Polyclonal Antibody (orb581210)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review