You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583419 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Ythdf1 |
Target | Ythdf1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ythdf1 |
Protein Sequence | Synthetic peptide located within the following region: PAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDTLNK |
UniProt ID | Q4V8J6 |
MW | 61kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001019927 |
Sample Type: Rat Thymus lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |