You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326571 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to YTHDC1 |
Target | YTHDC1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human YTHDC1 |
Protein Sequence | Synthetic peptide located within the following region: GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR |
UniProt ID | Q96MU7 |
MW | 83kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti KIAA1966 antibody, anti YT521 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_588611 |
Positive control (+): Human Ovary (OV), Negative control (-): Human lung (LU), Antibody concentration: 3 ug/mL.
WB Suggested Anti-YTHDC1 Antibody, Titration: 1.0 ug/mL, Positive Control: Placenta.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast | |
Rabbit | |
Polyclonal | |
FITC |