You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
XRN1 Rabbit Polyclonal Antibody
Catalog Number: orb577837
| Catalog Number | orb577837 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to XRN1 |
| Target | XRN1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human XRN1 |
| Protein Sequence | Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM |
| UniProt ID | Q8IZH2 |
| MW | 194 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | 45170 |
| Research Area | Cell Biology, Epigenetics & Chromatin, Molecular B Read more... |
| Note | For research use only |
| NCBI | NP_061874 |
| Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.1 ug/ml of the antibody was used in this experiment. The peptide is present in an isoform at ~54 kDa.
WB Suggested Anti-XRN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
