XPO1 Rabbit Polyclonal Antibody

• Catalog Number: orb577602
• Category: Antibodies
• Description: Rabbit polyclonal antibody to XPO1
• Target: XPO1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human XPO1
• Protein Sequence: Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
• UniProt ID: O14980
• MW: 123 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: emb, CRM1, exp1, CRM-1
• Note: For research use only
• NCBI: NP_003391

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is modified by phosphorylation.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. XPO1 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. XPO1 is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-XPO1 Antibody, Catalog Number: orb577602, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in pinealocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-XPO1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.