Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

WNT7B Rabbit Polyclonal Antibody

SKU: orb577994

Description

WNT7B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of WNT7B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human WNT7B. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WNT7B
TargetWNT7B
Protein SequenceSynthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
Molecular Weight39 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • WNT7B Rabbit Polyclonal Antibody [orb100915]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • WNT7B rabbit pAb Antibody [orb772109]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • WNT7B Rabbit Polyclonal Antibody [orb670332]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • WNT7B Rabbit Polyclonal Antibody [orb382125]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • WNT7B Polyclonal Antibody [orb1417234]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WNT7B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

WNT7B Rabbit Polyclonal Antibody

Anti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody orb577994 concentration 5 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human MKN45 Whole Cell, Antibody Dilution: 5 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_478679

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

WNT7B Rabbit Polyclonal Antibody (orb577994)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry