Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Wnt3a Rabbit Polyclonal Antibody

SKU: orb584128

Description

Wnt3a Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Wnt3a. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetWnt3a
Protein SequenceSynthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA
Molecular Weight38kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

vt, Wnt-, Wnt-3a

Similar Products

  • Wnt3a Rabbit Polyclonal Antibody [orb11573]

    WB

    Bovine, Canine, Human, Mouse, Porcine, Rabbit, Sheep

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • WNT3A Rabbit Polyclonal Antibody [orb584127]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • WNT3A Rabbit Polyclonal Antibody [orb632618]

    ELISA,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • WNT3A Rabbit Polyclonal Antibody [orb2955057]

    ELISA,  IHC,  WB

    Gallus, Human, Mouse, Rat, Xenopus

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Protein Wnt-3a Wnt3a Rabbit Polyclonal Antibody [orb137923]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Wnt3a Rabbit Polyclonal Antibody

Sample Type: Mouse Heart, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

Wnt3a Rabbit Polyclonal Antibody

Immunohistochemistry with Placenta tissue at an antibody concentration of dilution: 1:500 using anti-Wnt3a antibody (orb584128).

Wnt3a Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Wnt3a Rabbit Polyclonal Antibody

WB Suggested Anti-Wnt3a Antibody Titration: 1 ug/ml, Positive Control: Mouse Heart lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_033548

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Wnt3a Rabbit Polyclonal Antibody (orb584128)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry