WHAMM antibody

• Catalog Number: orb326586
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WHAMM
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Canine, Human, Porcine, Rat
• Reactivity: Canine, Equine, Human, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WHAMM
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 91kDa
• Target: WHAMM
• UniProt ID: Q8TF30
• Protein Sequence: Synthetic peptide located within the following region: SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP
• NCBI: NP_001073904
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA1971 antibody, anti WHDC1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Placenta tissue using WHAMM antibody