Cart summary

You have no items in your shopping cart.

WFDC5 Rabbit Polyclonal Antibody (FITC)

WFDC5 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108625

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108625
CategoryAntibodies
DescriptionWFDC5 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Guinea pig, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human WFDC5
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW11kDa
UniProt IDQ8TCV5
Protein SequenceSynthetic peptide located within the following region: MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV
NCBINP_663627
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPRG5, WAP1, dJ211D12.5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.