Cart summary

You have no items in your shopping cart.

WDTC1 Rabbit Polyclonal Antibody (Biotin)

WDTC1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2105470

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105470
CategoryAntibodies
DescriptionWDTC1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human WDTC1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW76kDa
UniProt IDQ5SSC5
Protein SequenceSynthetic peptide located within the following region: PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN
NCBINP_055838
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesADP, DCAF9
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.