Cart summary

You have no items in your shopping cart.

    WDR87 Antibody - C-terminal region : FITC

    WDR87 Antibody - C-terminal region : FITC

    Catalog Number: orb2097153

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2097153
    CategoryAntibodies
    DescriptionWDR87 Antibody - C-terminal region : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW150kDa
    UniProt IDQ6ZQQ6
    Protein SequenceSynthetic peptide located within the following region: PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS
    NCBIBAC87627
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesNYD-SP11
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars