Cart summary

You have no items in your shopping cart.

WDR66 Rabbit Polyclonal Antibody (FITC)

WDR66 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108832

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108832
CategoryAntibodies
DescriptionWDR66 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human WDR66
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW40kDa
UniProt IDQ8TBY9
Protein SequenceSynthetic peptide located within the following region: DLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRD
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesWDR66, SPGF33, CaM-IP4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.