WDR5 Rabbit Polyclonal Antibody

• Catalog Number: orb577998
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WDR5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WDR5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: WDR5
• UniProt ID: Q5M786
• Protein Sequence: Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI
• NCBI: NP_060058
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SWD3, BIG-3, CFAP89
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: WDR5, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: WDR5.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 2 ug/ml.

Sample Type: Human brain stem cells (NT2), Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: WDR5 Blue: DAPI, Gene Name: WDR5.

WB Suggested Anti-WDR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.