WDR48 Rabbit Polyclonal Antibody

• Catalog Number: orb588519
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WDR48
• Target: WDR48
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WDR48
• Protein Sequence: Synthetic peptide located within the following region: YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDP
• UniProt ID: Q8TAF3
• MW: 74 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P80, UAF1, Bun62, SPG60
• Research Area: Cell Biology, Immunology & Inflammation, Stem Cell
• Note: For research use only
• NCBI: NP_065890

Sample Tissue: Human COLO205 Whole Cell lysates, Antibody Dilution: 1 ug/ml.