You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb2008431 |
|---|---|
| Category | Proteins |
| Description | Wdfy1 Peptide - N-terminal region |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA |
| UniProt ID | Q9DAD3 |
| MW | 21kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with Wdfy1 Rabbit Polyclonal Antibody (orb583576). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | 1700013B03Rik, 1700120F24Rik, FENS-1, Jr1, KIAA143 Read more... |
| Note | For research use only |
| NCBI | NP_081333 |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review