WDFY1 Peptide - N-terminal region

• Catalog Number: orb2008430
• Category: Proteins
• Description: WDFY1 Peptide - N-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV
• UniProt ID: Q8IWB7
• MW: 46kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with WDFY1 Rabbit Polyclonal Antibody (orb583575). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: FENS-1, WDF1, ZFYVE17
• Note: For research use only
• NCBI: NP_065881
• Expiration Date: 6 months from date of receipt.