Wdfy1 Rabbit Polyclonal Antibody

• Catalog Number: orb583576
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Wdfy1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: Wdfy1
• UniProt ID: Q9DAD3
• Protein Sequence: Synthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA
• NCBI: NP_081333
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Jr, Jr1, WDF1, FENS-1, ZFYVE17, mKIAA1435, 1700013
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around ~25 kDa.

Rabbit Anti-Wdfy1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 10 ug/ml.

Rabbit Anti-Wdfy1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 10 ug/ml.

WB Suggested Anti-Wdfy1 Antibody, Titration: 1.0 ug/ml, Positive Control: Human kidney.

WB Suggested Anti-Wdfy1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.