Cart summary

You have no items in your shopping cart.

WBP11 Rabbit Polyclonal Antibody

SKU: orb325262

Description

Rabbit polyclonal antibody to WBP11

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsIHC, IP, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human WBP11
TargetWBP11
Protein SequenceSynthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
Molecular Weight70kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DKFZp779M1063 antibody, anti NPWBP antibody, anti SIPP1 antibody, anti WBP-11 antibody

Similar Products

  • WBP11 Rabbit Polyclonal Antibody [orb632575]

    ELISA,  IF,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • WBP11 Rabbit Polyclonal Antibody [orb668633]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • WBP11 Rabbit Polyclonal Antibody (HRP) [orb2117012]

    IHC,  IP,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • WBP11 Rabbit Polyclonal Antibody (FITC) [orb2117013]

    IHC,  IP,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • WBP11 Rabbit Polyclonal Antibody (Biotin) [orb2117014]

    IHC,  IP,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WBP11 Rabbit Polyclonal Antibody

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: WBP11, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: WBP11.

WBP11 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

WBP11 Rabbit Polyclonal Antibody

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: WBP11.

WBP11 Rabbit Polyclonal Antibody

Rabbit Anti-WBP11 Antibody, Catalog Number: orb325262, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WBP11 Rabbit Polyclonal Antibody

WB Suggested Anti-WBP11 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate, WBP11 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_057396

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

WBP11 Rabbit Polyclonal Antibody (orb325262)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry