WARS2 Rabbit Polyclonal Antibody

• Catalog Number: orb581679
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WARS2
• Target: WARS2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WARS2
• Protein Sequence: Synthetic peptide located within the following region: TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
• UniProt ID: Q9UGM6
• MW: 24kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TrpRS, NEMMLAS, mtTrpRS
• Note: For research use only
• NCBI: NP_957715

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

WB Suggested Anti-WARS2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.