Cart summary

You have no items in your shopping cart.

VSX1 Rabbit Polyclonal Antibody (Biotin)

VSX1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2132795

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2132795
CategoryAntibodies
DescriptionVSX1 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Yeast
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human VSX1
Protein SequenceSynthetic peptide located within the following region: FLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASP
UniProt IDQ9NZR4
MW38kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesPPD, KTCN, PPCD, RINX, KTCN1, PPCD1, CAASDS
NoteFor research use only
NCBINP_055403