Cart summary

You have no items in your shopping cart.

VSIR Rabbit Polyclonal Antibody (Biotin)

VSIR Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2112772

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112772
CategoryAntibodies
DescriptionVSIR Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C10orf54
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW34kDa
UniProt IDQ9H7M9
Protein SequenceSynthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
NCBINP_071436
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesB7H5, GI24, B7-H5, Dies1, PD-1H, SISP1, VISTA, PP2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.