VSIG4 Rabbit Polyclonal Antibody

• Catalog Number: orb578126
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VSIG4
• Target: VSIG4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: PCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVS
• UniProt ID: C9J1L3
• MW: 24kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CRIg, Z39IG
• Note: For research use only
• NCBI: NP_001171760

Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): Human Brain (BR), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.