You have no items in your shopping cart.
VMP1 Rabbit Polyclonal Antibody
SKU: orb330604
Description
Research Area
Cell Biology
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human VMP1 |
| Target | VMP1 |
| Protein Sequence | Synthetic peptide located within the following region: SIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEML |
| Molecular Weight | 44kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti VMP1 antibody, anti TDC1 antibody, anti TMEM49 antibody, anti HSPC292 antibody, anti antibody
Similar Products
−TMEM49 Rabbit Polyclonal Antibody [orb100176]
IF, IHC-Fr, IHC-P, WB
Equine, Human, Porcine, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
Documents Download
Datasheet
Product Information
Request a Document
VMP1 Rabbit Polyclonal Antibody (orb330604)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









