Viral Spike glycoprotein protein

SKU: orb419343

Description

This Viral Spike glycoprotein protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology

Images & Validation

• Application Notes:
  Tag Info: N-terminal 10xHis-taggedExpression Region: 326-540aaSequence Info: Extracellular Domain

Key Properties

• Source: E.coli
• Biological Origin: Bovine coronavirus (strain Mebus) (BCoV) (BCV)
• Tag: N-terminal 10xHis-tagged
• Expression Region: 326-540aa
• Protein Length: Partial
• MW: 27.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

E2 Peplomer protein

Quick Database Links

UniProt

P15777