Viral Envelope glycoprotein protein

• Catalog Number: orb358919
• Category: Proteins
• Description: Recombinant viral Envelope glycoprotein protein
• Tag: N-terminal 6xHis-Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 19.4 kDa
• UniProt ID: Q7T9D9
• Protein Sequence: QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Sudan ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola virus)
• Expression Region: 502-637aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: GP1,2 Short name, GP
• Note: For research use only
• Application notes: Partial of HIS-tag and expression region is 23.16kDa
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.