You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580337 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VIM |
Target | VIM |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human VIM |
Protein Sequence | Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR |
UniProt ID | P08670 |
MW | 54kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FLJ36605 |
Research Area | Epigenetics, Infectious Diseases |
Note | For research use only |
NCBI | NP_003371 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.
Rabbit Anti-VIM Antibody, Catalog Number: orb580337, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: VIM: Red DAPI:Blue, Gene Name: VIM.
The Vimentin antibody orb580337 works well for visualization of the vimentin cytoskeleton. We used PFA-fixed COS-7 cells and an antibody dilution of 1:400.
WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Gallus, Goat, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |