Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

VIM Rabbit Polyclonal Antibody

SKU: orb580337

Description

VIM Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of VIM. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human VIM. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics, Infectious Diseases

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human VIM
TargetVIM
Protein SequenceSynthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
Molecular Weight54kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FLJ36605

Similar Products

  • Vimentin Rabbit Polyclonal Antibody [orb11559]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  KO/KD Validated,  WB

    Bovine, Gallus, Goat, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Vimentin Rabbit Polyclonal Antibody [orb251542]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Vimentin Rabbit Polyclonal Antibody [orb158714]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  KO/KD Validated,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Vimentin Antibody [orb1927593]

    FC,  IF,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Vimentin Antibody (C-term) [orb1931502]

    FC,  IF,  IHC-P,  WB

    Hamster, Mouse, Other, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

VIM Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

VIM Rabbit Polyclonal Antibody

Rabbit Anti-VIM Antibody, Catalog Number: orb580337, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

VIM Rabbit Polyclonal Antibody

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: VIM: Red DAPI:Blue, Gene Name: VIM.

VIM Rabbit Polyclonal Antibody

The Vimentin antibody orb580337 works well for visualization of the vimentin cytoskeleton. We used PFA-fixed COS-7 cells and an antibody dilution of 1:400.

VIM Rabbit Polyclonal Antibody

WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003371

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

VIM Rabbit Polyclonal Antibody (orb580337)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry