VEGFA Rabbit Polyclonal Antibody

• Catalog Number: orb584862
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VEGFA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: VEGFA
• UniProt ID: P15692
• Protein Sequence: Synthetic peptide located within the following region: SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPR
• NCBI: NP_001191314
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: VPF, VEGF, MVCD1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Liver (LI), Negative control (-): Human Brain (BR), Antibody concentration: 3 ug/ml.

Sample Type: LNCap cells, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: Brown: VEGFA Blue: DAPI, Gene Name: VEGFA.

WB Suggested Anti-VEGFA Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.