Cart summary

You have no items in your shopping cart.

USP9Y Rabbit Polyclonal Antibody (FITC)

USP9Y Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2098869

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2098869
CategoryAntibodies
DescriptionUSP9Y Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human USP9Y
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW291kDa
UniProt IDO00507
Protein SequenceSynthetic peptide located within the following region: PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP
NCBINP_004645
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesDFFRY, SPGFY2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.