USP9X Rabbit Polyclonal Antibody

SKU: orb584303

Description

USP9X Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of USP9X. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human USP9X. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human USP9X
• Target: USP9X
• Protein Sequence: Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
• Molecular Weight: 292kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FAF, FAM, DFFRX, MRX99, MRXS99F

Quick Database Links

Gene Symbol

USP9X

UniProt

Q93008

RefSeq (Protein):NP_001034679