You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584303 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to USP9X |
Target | USP9X |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human USP9X |
Protein Sequence | Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ |
UniProt ID | Q93008 |
MW | 292kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FAF, FAM, DFFRX, MRX99, MRXS99F |
Research Area | Cell Biology, Protein Biochemistry |
Note | For research use only |
NCBI | NP_001034679 |
Expiration Date | 12 months from date of receipt. |
mouse 3T3 s
Sample Type: 1. total HeLa cell extract (100 ug), 2. total HeLa cell extract incubated with HA-UbVME (100 ug), 3. Rat Liver cytosolic extract (100 ug), 4. Rat Liver cytosolic extract incubated with HA-UbVME (100 ug), Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary dilution: 1:1000.
WB Suggested Anti-USP9X Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. USP9X is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Human, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |