USP9X Rabbit Polyclonal Antibody

• Catalog Number: orb584303
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USP9X
• Target: USP9X
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human USP9X
• Protein Sequence: Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
• UniProt ID: Q93008
• MW: 292kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FAF, FAM, DFFRX, MRX99, MRXS99F
• Research Area: Cell Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_001034679

mouse 3T3 s

Sample Type: 1. total HeLa cell extract (100 ug), 2. total HeLa cell extract incubated with HA-UbVME (100 ug), 3. Rat Liver cytosolic extract (100 ug), 4. Rat Liver cytosolic extract incubated with HA-UbVME (100 ug), Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary dilution: 1:1000.

WB Suggested Anti-USP9X Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. USP9X is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.