USP17L2 Rabbit Polyclonal Antibody

• Catalog Number: orb584282
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USP17L2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP17L2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59kDa
• Target: USP17L2
• UniProt ID: Q6R6M4
• Protein Sequence: Synthetic peptide located within the following region: FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
• NCBI: NP_958804
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DUB3, DUB-3, USP17
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human LN18 Whole Cell, Antibody dilution: 5 ug/ml.

WB Suggested Anti-USP17L2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.