Cart summary

You have no items in your shopping cart.

USP17L2 Rabbit Polyclonal Antibody

Catalog Number: orb584282

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 3-7 working days
Product Properties
Catalog Numberorb584282
CategoryAntibodies
DescriptionRabbit polyclonal antibody to USP17L2
TargetUSP17L2
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human USP17L2
Protein SequenceSynthetic peptide located within the following region: FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
UniProt IDQ6R6M4
MW59kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesDUB3, DUB-3, USP17
Research AreaCell Biology, Protein Biochemistry
NoteFor research use only
NCBINP_958804
Images
USP17L2 Rabbit Polyclonal Antibody

Sample Tissue: Human LN18 Whole Cell, Antibody dilution: 5 ug/ml.

USP17L2 Rabbit Polyclonal Antibody

WB Suggested Anti-USP17L2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.

Similar Products
Reviews

USP17L2 Rabbit Polyclonal Antibody (orb584282)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet