You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330447 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to USP16 |
| Target | USP16 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human USP16 |
| Protein Sequence | Synthetic peptide located within the following region: CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS |
| UniProt ID | Q5VKN8 |
| MW | 44kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti UBP-M antibody |
| Research Area | Cell Biology, Disease Biomarkers, Epigenetics & Ch Read more... |
| Note | For research use only |
| NCBI | AAR13293 |

Sample Type: Human brain stem cells (NT2), Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: USP16 Blue: DAPI, Gene Name: USP16.

WB Suggested Anti-USP16 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate.
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review