You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331287 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to USO1 |
Target | USO1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: QNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQ |
UniProt ID | O60763 |
MW | 108kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti P115 antibody, anti TAP antibody, anti VDP an Read more... |
Note | For research use only |
NCBI | NP_003706 |
WB Suggested Anti-USO1 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell, USO1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
IF, IH, IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |