USF1 Rabbit Polyclonal Antibody

SKU: orb575081

Description

Rabbit polyclonal antibody to USF1

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USF1
• Target: USF1
• Protein Sequence: Synthetic peptide located within the following region: KGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVF
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

UEF, FCHL, MLTF, FCHL1, MLTFI, HYPLIP1, bHLHb11

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

Rabbit Anti-USF1 Antibody, Catalog Number: orb575081, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-USF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

USF1

UniProt

P22415

RefSeq (Protein):NP_009053