Use1 Rabbit Polyclonal Antibody

• Catalog Number: orb576285
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Use1
• Target: Use1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2010315L10RIK
• Protein Sequence: Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL
• UniProt ID: Q9CQ56
• MW: 30kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: D12, Ed2, Q-S, p31, Q-snare, AV002165, 2010315L10R
• Note: For research use only
• NCBI: NP_080193
• Expiration Date: 12 months from date of receipt.

Mouse Skin

WB Suggested Antibody Titration: 0.2-1 ug/ml, Positive Control: SP20.