MDS032 Rabbit Polyclonal Antibody

• Catalog Number: orb324792
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USE1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MDS032
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: USE1
• UniProt ID: Q9NZ43
• Protein Sequence: Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE
• NCBI: NP_060937
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti P31 antibody, anti SLT1 antibody, anti MDS032
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Intestine

WB Suggested Anti-MDS032 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, USE1 is supported by BioGPS gene expression data to be expressed in Jurkat.