You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578184 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UROD |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UROD |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | UROD |
UniProt ID | P06132 |
Protein Sequence | Synthetic peptide located within the following region: VPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVP |
NCBI | NP_000365 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PCT, UPD Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human HepG2
Rabbit Anti-UROD Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-UROD Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. UROD is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |