UROD Rabbit Polyclonal Antibody

• Catalog Number: orb578184
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UROD
• Target: UROD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UROD
• Protein Sequence: Synthetic peptide located within the following region: VPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVP
• UniProt ID: P06132
• MW: 40kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PCT, UPD
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_000365

Human HepG2

Rabbit Anti-UROD Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-UROD Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. UROD is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.