Cart summary

You have no items in your shopping cart.

UNC84A Rabbit Polyclonal Antibody (Biotin)

UNC84A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2112397

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112397
CategoryAntibodies
DescriptionUNC84A Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A
Protein SequenceSynthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
UniProt IDO94901
MW78kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesUNC84A
NoteFor research use only
NCBINP_079430