You have no items in your shopping cart.
UNC84A Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A |
| Target | SUN1 |
| Protein Sequence | Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA |
| Molecular Weight | 90kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SUN1 Rabbit Polyclonal Antibody [orb631646]
ELISA, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgSUN1 Rabbit Polyclonal Antibody [orb668317]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl, 30 μlUNC84A Rabbit Polyclonal Antibody [orb513375]
ELISA, IHC, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Mouse C2C12 cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: UNC84a: Green DAPI: Blue, Gene Name: UNC84A.

WB Suggested Anti-UNC84A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.
Documents Download
Request a Document
Protocol Information
UNC84A Rabbit Polyclonal Antibody (orb325524)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

