UGT1A7 Rabbit Polyclonal Antibody

• Catalog Number: orb580734
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UGT1A7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: UGT1A7
• UniProt ID: Q5DSZ7
• Protein Sequence: Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
• NCBI: NP_061950
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GNT1, UGT1, UDPGT, UGT1A, UGT1G, UGT-1A, UGT-1G, U
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-UGT1A7 Antibody, Catalog Number: orb580734, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-UGT1A7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B.